PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10007904m
Common NameCICLE_v10007904mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family WRKY
Protein Properties Length: 554aa    MW: 60623.8 Da    PI: 6.5843
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10007904mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY102.62.2e-32134191260
                      --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
             WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                      +DgynWrKYGqK+vkgse+prsYY+Ct+++C+vkkkvers  +++++ei+Y+g Hnh+k
  Ciclev10007904m 134 EDGYNWRKYGQKQVKGSEYPRSYYKCTHPNCQVKKKVERSL-EGHITEIIYKGAHNHPK 191
                      7****************************************.***************85 PP

2WRKY104.27e-33346404159
                      ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
             WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                      ldDgy+WrKYGqK+vkg+++prsYY+CtsagC+v+k+ver+++d k v++tYeg+Hnh+
  Ciclev10007904m 346 LDDGYRWRKYGQKVVKGNPNPRSYYKCTSAGCTVRKHVERASHDLKSVITTYEGKHNHD 404
                      59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5081122.848128192IPR003657WRKY domain
Gene3DG3DSA:2.20.25.802.6E-28132192IPR003657WRKY domain
SMARTSM007746.8E-36133191IPR003657WRKY domain
SuperFamilySSF1182901.83E-25133192IPR003657WRKY domain
PfamPF031061.1E-24134190IPR003657WRKY domain
Gene3DG3DSA:2.20.25.803.7E-37331406IPR003657WRKY domain
SuperFamilySSF1182901.11E-28338406IPR003657WRKY domain
PROSITE profilePS5081138.664341406IPR003657WRKY domain
SMARTSM007741.5E-37346405IPR003657WRKY domain
PfamPF031064.6E-25347404IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009555Biological Processpollen development
GO:0009942Biological Processlongitudinal axis specification
GO:0030010Biological Processestablishment of cell polarity
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 554 aa     Download sequence    Send to blast
MAGFLMLFVK HFHFLSVEYC LTSTYRFTFT HPQQSFPSIE VSVQSENSPQ NVNAAKVHSQ  60
YRNSLSLQVQ TDFSRATTEK DNGCNTILAD QRVFDTFGGS TEHSPPLDEQ QDEEGDQRGS  120
GDSMVAGAGG ASSEDGYNWR KYGQKQVKGS EYPRSYYKCT HPNCQVKKKV ERSLEGHITE  180
IIYKGAHNHP KPPPNRRSAI GSNPLDMQLD IHEQAGLQSG ADGDPSWANT QKGTAGGTPE  240
WRHDTVEVTS AAPVGPEYCN QSSALPAQNG TPYESGDAVD ASSTFSNDED EDDQVTHCSV  300
GFDGEEDESE SKRRKIEAYA TEMSGATRAI REPRVVVQTT SEVDILDDGY RWRKYGQKVV  360
KGNPNPRSYY KCTSAGCTVR KHVERASHDL KSVITTYEGK HNHDVPAARN SSHVNSGSSS  420
AVSAHAAAGG QIHRPEPSQL HNSMARFDRP ASFGSFRVPG RQQFGPSPGF SFGMHQPGLA  480
NLSMAGLGPG QPELPVLPVH PYLAQQRQVN EMGFMMPKGE PKVEPMSEPG LNLSNRSAVY  540
QQLMSRLPLG PQM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A8e-37134407878Probable WRKY transcription factor 4
2lex_A8e-37134407878Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00071PBMTransfer from AT5G56270Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006452781.10.0hypothetical protein CICLE_v10007904mg
SwissprotQ9FG771e-151WRKY2_ARATH; Probable WRKY transcription factor 2
TrEMBLV4UTU40.0V4UTU4_9R
STRINGVIT_19s0015g01870.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM79542740
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56270.11e-148WRKY DNA-binding protein 2